PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT11673
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family Dof
Protein Properties Length: 490aa    MW: 53224.2 Da    PI: 7.2881
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT11673genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof117.93.8e-37116175362
    zf-Dof   3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
               + +++cprC+s++tkfCy+nny++sqPr+fC++C+ryWt+GG +rnvPvG+grr+nk++s
  EMT11673 116 DIIVPCPRCNSMETKFCYFNNYNVSQPRHFCRNCQRYWTAGGNIRNVPVGSGRRRNKHAS 175
               56789****************************************************976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-28112172IPR003851Zinc finger, Dof-type
PROSITE profilePS5088428.267119173IPR003851Zinc finger, Dof-type
PfamPF027012.7E-31119173IPR003851Zinc finger, Dof-type
PROSITE patternPS013610121157IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 490 aa     Download sequence    Send to blast
MAALRDRGDA AIKLFGRTIP LLDAAAEGGI AAPSSPPKRP PVVTKLGNDA NSNDVMPCVS  60
NKLLNVEATP FCSKNREQND QAISKHGVEV RTGFKSEEIK TGSDGSGQDK VLKKPDIIVP  120
CPRCNSMETK FCYFNNYNVS QPRHFCRNCQ RYWTAGGNIR NVPVGSGRRR NKHASHFRHA  180
MMSCDANIAA PGDVSNEIHH LALPLLPQVL PGPIKENETV KEFGSQVPVC KPMSSIHNIE  240
EQKDTHLVSL ASGDNSEEQS CPSPATVSGC SENHTPDSAV KKEPSNVLGY YNGITLPHPH  300
GPALVFPWSP GWNSIAVMAA AQCSTEPIQG LENVKHGLPP WAPPLMMAAP GICTPVVSFP  360
MMPPPLWSCI PGWPNGMWSS PCPGSNGPPN KITCSEDNSP TLGKHSREAD LQEEDRENNV  420
QVPKTLRIDD PAETTKTSVR DTLGIKPDEK GMFEPFQMKV LKNDKTPESP QALQANPAAF  480
SRSQSFQERT
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00394DAPTransfer from AT3G47500Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankHG6703060.0HG670306.1 Triticum aestivum chromosome 3B, genomic scaffold, cultivar Chinese Spring.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003565663.10.0PREDICTED: cyclic dof factor 2-like
TrEMBLM8C9680.0M8C968_AEGTA; Dof zinc finger protein
STRINGMLOC_79421.20.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP143438116
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47500.18e-58cycling DOF factor 3